Lineage for d1r4ta_ (1r4t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700261Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 2700262Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)
  6. 2700276Protein automated matches [254426] (1 species)
    not a true protein
  7. 2700277Species Pseudomonas aeruginosa [TaxId:287] [254884] (1 PDB entry)
  8. 2700278Domain d1r4ta_: 1r4t A: [240749]
    automated match to d1he1a_

Details for d1r4ta_

PDB Entry: 1r4t (more details)

PDB Description: solution structure of exoenzyme s
PDB Compounds: (A:) exoenzyme s

SCOPe Domain Sequences for d1r4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ta_ a.24.11.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
pmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqveesriqagr
llersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallrqavesevsr
vs

SCOPe Domain Coordinates for d1r4ta_:

Click to download the PDB-style file with coordinates for d1r4ta_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ta_: