SCOPe 2.07: Domain d1r4ta_: 1r4t A:

Lineage for d1r4ta_ (1r4t A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)
   contains extra helices in the loops at one end of the bundle

5. Family a.24.11.1: Bacterial GAP domain [47234] (4 protein domains)

6. Protein automated matches [254426] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [254884] (1 PDB entry)

8. Domain d1r4ta_: 1r4t A: [240749]
   automated match to d1he1a_

Details for d1r4ta_

PDB Entry: 1r4t

PDB Description: Solution structure of exoenzyme S

PDB Compounds: (A:) exoenzyme s

SCOPe Domain Sequences for d1r4ta_:

Sequence; same for both SEQRES and ATOM records:

>d1r4ta_ a.24.11.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
pmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqveesriqagr
llersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallrqavesevsr
vs

Timeline for d1r4ta_:

• d1r4ta_ first appeared in SCOPe 2.04
  
• d1r4ta_ appears in SCOPe 2.06