SCOPe 2.04: Domain d1ojlc_: 1ojl C:

Lineage for d1ojlc_ (1ojl C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [254883] (1 PDB entry)

8. Domain d1ojlc_: 1ojl C: [240747]
   automated match to d1ny6c_
   complexed with atp, po4

Details for d1ojlc_

PDB Entry: 1ojl, 3 Å

PDB Description: crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding

PDB Compounds: (C:) transcriptional regulatory protein zrar

SCOPe Domain Sequences for d1ojlc_:

Sequence; same for both SEQRES and ATOM records:

>d1ojlc_ c.37.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 602]}
shmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnc
aalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllraiq
erevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrred
iplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyis
erelplaiaatp

Timeline for d1ojlc_:

• d1ojlc_ is new in SCOPe 2.04-stable
  
• d1ojlc_ appears in SCOPe 2.05
  
• d1ojlc_ appears in the current release, SCOPe 2.08