Lineage for d1ojlb_ (1ojl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872826Species Salmonella typhimurium [TaxId:602] [254883] (1 PDB entry)
  8. 2872827Domain d1ojlb_: 1ojl B: [240746]
    automated match to d1ny6c_
    complexed with atp, po4

Details for d1ojlb_

PDB Entry: 1ojl (more details), 3 Å

PDB Description: crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding
PDB Compounds: (B:) transcriptional regulatory protein zrar

SCOPe Domain Sequences for d1ojlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojlb_ c.37.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 602]}
shmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnc
aalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllraiq
erevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrred
iplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyis
erelplaiaat

SCOPe Domain Coordinates for d1ojlb_:

Click to download the PDB-style file with coordinates for d1ojlb_.
(The format of our PDB-style files is described here.)

Timeline for d1ojlb_: