Lineage for d4pwtb_ (4pwt B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658417Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 1658418Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 1658427Protein automated matches [190318] (2 species)
    not a true protein
  7. 1658437Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries)
  8. 1658439Domain d4pwtb_: 4pwt B: [240744]
    automated match to d4pwta_
    complexed with fmt, pop, so4

Details for d4pwtb_

PDB Entry: 4pwt (more details), 1.75 Å

PDB Description: Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
PDB Compounds: (B:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d4pwtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwtb_ d.79.7.1 (B:) automated matches {Yersinia pestis [TaxId: 214092]}
natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv
vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf
aknrravlvy

SCOPe Domain Coordinates for d4pwtb_:

Click to download the PDB-style file with coordinates for d4pwtb_.
(The format of our PDB-style files is described here.)

Timeline for d4pwtb_: