| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
| Protein automated matches [190318] (2 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries) |
| Domain d4pwtb_: 4pwt B: [240744] automated match to d4pwta_ complexed with fmt, pop, so4 |
PDB Entry: 4pwt (more details), 1.75 Å
SCOPe Domain Sequences for d4pwtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwtb_ d.79.7.1 (B:) automated matches {Yersinia pestis [TaxId: 214092]}
natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv
vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf
aknrravlvy
Timeline for d4pwtb_: