SCOPe 2.03: Domain d1loa.3: 1loa E:,F:

Lineage for d1loa.3 (1loa E:,F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1loa.3: 1loa E:,F: [24074]
   complexed with ca, gyp, mn

Details for d1loa.3

PDB Entry: 1loa, 2.2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide- binding site

PDB Compounds: (E:) legume isolectin I (alpha chain), (F:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1loa.3:

Sequence; same for both SEQRES and ATOM records:

>g1loa.3 b.29.1.1 (E:,F:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

Timeline for d1loa.3:

• d1loa.3 first appeared (with stable ids) in SCOP 1.55
  
• d1loa.3 appears in SCOPe 2.02
  
• d1loa.3 appears in SCOPe 2.04
  
• d1loa.3 appears in the current release, SCOPe 2.08