Lineage for d1loa.3 (1loa E:,F:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57743Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 57762Domain d1loa.3: 1loa E:,F: [24074]

Details for d1loa.3

PDB Entry: 1loa (more details), 2.2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide-binding site

SCOP Domain Sequences for d1loa.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1loa.3 b.29.1.1 (E:,F:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

SCOP Domain Coordinates for d1loa.3:

Click to download the PDB-style file with coordinates for d1loa.3.
(The format of our PDB-style files is described here.)

Timeline for d1loa.3: