Lineage for d4posd_ (4pos D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823375Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)
  8. 2823399Domain d4posd_: 4pos D: [240736]
    automated match to d4posb_
    complexed with ca, edo, ipa

Details for d4posd_

PDB Entry: 4pos (more details), 2 Å

PDB Description: structure of human polyomavirus 9 vp1 pentamer in complex with 3'- sialyllactosamine
PDB Compounds: (D:) vp1

SCOPe Domain Sequences for d4posd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4posd_ b.121.6.1 (D:) automated matches {Human polyomavirus 9 [TaxId: 943908]}
gvevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlpty
svaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgt
tlhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvev
wspdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdiv
gihtnysesqnwrglpryfnvtlrkrvvknp

SCOPe Domain Coordinates for d4posd_:

Click to download the PDB-style file with coordinates for d4posd_.
(The format of our PDB-style files is described here.)

Timeline for d4posd_: