SCOPe 2.05: Domain d4poff_: 4pof F:

Lineage for d4poff_ (4pof F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [238494] (1 PDB entry)

8. Domain d4poff_: 4pof F: [240732]
   automated match to d4pofb_
   complexed with zn

Details for d4poff_

PDB Entry: 4pof, 2.65 Å

PDB Description: PfMCM N-terminal domain without DNA

PDB Compounds: (F:) Cell division control protein 21

SCOPe Domain Sequences for d4poff_:

Sequence; same for both SEQRES and ATOM records:

>d4poff_ b.40.4.0 (F:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
svdreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahe
vienpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqve
givtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssf
vnfqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpi
frkilevnhiepvsk

Timeline for d4poff_:

• d4poff_ first appeared in SCOPe 2.04
  
• d4poff_ is called d4poff1 in SCOPe 2.06
  
• d4poff_ appears in the current release, SCOPe 2.08, called d4poff1