SCOPe 2.06: Domain d4pofe1: 4pof E:2-254

Lineage for d4pofe1 (4pof E:2-254)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [238494] (2 PDB entries)

8. Domain d4pofe1: 4pof E:2-254 [240731]
   Other proteins in same PDB: d4pofa2, d4pofb2, d4pofc2, d4pofd2, d4pofe2, d4poff2
   automated match to d4pofb_
   complexed with zn

Details for d4pofe1

PDB Entry: 4pof, 2.65 Å

PDB Description: PfMCM N-terminal domain without DNA

PDB Compounds: (E:) Cell division control protein 21

SCOPe Domain Sequences for d4pofe1:

Sequence; same for both SEQRES and ATOM records:

>d4pofe1 b.40.4.0 (E:2-254) automated matches {Pyrococcus furiosus [TaxId: 186497]}
dreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahevi
enpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqvegi
vtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssfvn
fqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpifr
kilevnhiepvsk

Timeline for d4pofe1:

• d4pofe1 first appeared in SCOPe 2.04, called d4pofe_
  
• d4pofe1 was called d4pofe_ in SCOPe 2.05
  
• d4pofe1 appears in SCOPe 2.07
  
• d4pofe1 appears in the current release, SCOPe 2.08