SCOPe 2.07: Domain d4p32b_: 4p32 B:

Lineage for d4p32b_ (4p32 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (134 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries)

8. Domain d4p32b_: 4p32 B: [240728]
   automated match to d4p32a_
   complexed with adp, mg

Details for d4p32b_

PDB Entry: 4p32, 1.55 Å

PDB Description: crystal structure of e. coli lptb in complex with adp-magnesium

PDB Compounds: (B:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d4p32b_:

Sequence; same for both SEQRES and ATOM records:

>d4p32b_ c.37.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvk

Timeline for d4p32b_:

• d4p32b_ first appeared in SCOPe 2.04
  
• d4p32b_ appears in SCOPe 2.06