![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries) |
![]() | Domain d4oq5d1: 4oq5 D:174-320 [240722] Other proteins in same PDB: d4oq5a2, d4oq5b2, d4oq5c2, d4oq5d2, d4oq5e2, d4oq5f2 automated match to d4oq5b_ complexed with 2uu |
PDB Entry: 4oq5 (more details), 2.86 Å
SCOPe Domain Sequences for d4oq5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oq5d1 f.1.4.1 (D:174-320) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]} lyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgmlr kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes itdvlvrtkrdwlvkqrgwdgfveffh
Timeline for d4oq5d1: