Lineage for d4oo4a_ (4oo4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852606Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 1852607Domain d4oo4a_: 4oo4 A: [240719]
    automated match to d4oo4b_
    mutant

Details for d4oo4a_

PDB Entry: 4oo4 (more details), 0.97 Å

PDB Description: Crystal Structure of Human Thioredoxin Mutant
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4oo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oo4a_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcadvasesevksmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d4oo4a_:

Click to download the PDB-style file with coordinates for d4oo4a_.
(The format of our PDB-style files is described here.)

Timeline for d4oo4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4oo4b_