SCOP 1.55: Domain d1lod.4: 1lod G:,H:

Lineage for d1lod.4 (1lod G:,H:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Lectin [49904] (15 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1lod.4: 1lod G:,H: [24071]

Details for d1lod.4

PDB Entry: 1lod, 2.05 Å

PDB Description: interaction of a legume lectin with two components of the bacterial cell wall

SCOP Domain Sequences for d1lod.4:

Sequence; same for both SEQRES and ATOM records:

>g1lod.4 b.29.1.1 (G:,H:) Lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

Timeline for d1lod.4:

• d1lod.4 appears in SCOP 1.57
  
• d1lod.4 appears in the current release, SCOPe 2.08