SCOPe 2.07: Domain d4oj7b_: 4oj7 B:

Lineage for d4oj7b_ (4oj7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.0: automated matches [237401] (1 protein)
   not a true family

6. Protein automated matches [237402] (7 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [237403] (2 PDB entries)

8. Domain d4oj7b_: 4oj7 B: [240709]
   automated match to d4oj7c_
   complexed with edo, no3

Details for d4oj7b_

PDB Entry: 4oj7, 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis

PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d4oj7b_:

Sequence; same for both SEQRES and ATOM records:

>d4oj7b_ a.130.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpa
yartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarva
plrdapdcpsrlarsianwktltrydsaqkdalgtalshvca

Timeline for d4oj7b_:

• d4oj7b_ first appeared in SCOPe 2.04
  
• d4oj7b_ appears in SCOPe 2.06
  
• d4oj7b_ does not appear in SCOPe 2.08