Lineage for d4ohsb_ (4ohs B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940976Species European sea anemone (Actinia equina) [TaxId:6106] [237221] (1 PDB entry)
  8. 2940978Domain d4ohsb_: 4ohs B: [240701]
    automated match to d4ohsa_
    complexed with cl

Details for d4ohsb_

PDB Entry: 4ohs (more details), 2.19 Å

PDB Description: The structure of a far-red fluorescent protein, AQ143
PDB Compounds: (B:) far-red fluorescent protein aq143

SCOPe Domain Sequences for d4ohsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohsb_ d.22.1.0 (B:) automated matches {European sea anemone (Actinia equina) [TaxId: 6106]}
plvtedmcikmtmegtinghhfkcvgegegkpfegtqvekiriteggplpfaydilapcc
mygmygsktfikhvsgipdyfkesfpegftwertqifedggsltihqdtslqgnnfifkv
nviganfpangpvmqkktagwepsveilyprdgvlcgqalmalkctdgdhltshlrttyr
srkpsnavnmpefhfgdhrieilkaeqgkfyeqyesavaryceaapsklgh

SCOPe Domain Coordinates for d4ohsb_:

Click to download the PDB-style file with coordinates for d4ohsb_.
(The format of our PDB-style files is described here.)

Timeline for d4ohsb_: