Lineage for d4ohja2 (4ohj A:134-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934575Protein automated matches [226944] (2 species)
    not a true protein
  7. 2934576Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries)
  8. 2934578Domain d4ohja2: 4ohj A:134-234 [240700]
    Other proteins in same PDB: d4ohja1, d4ohja3, d4ohjb1, d4ohjb3
    automated match to d4ohjb2

Details for d4ohja2

PDB Entry: 4ohj (more details), 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohja2 d.15.6.1 (A:134-234) automated matches {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d4ohja2:

Click to download the PDB-style file with coordinates for d4ohja2.
(The format of our PDB-style files is described here.)

Timeline for d4ohja2: