Lineage for d4ohja1 (4ohj A:42-133)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789154Protein automated matches [226992] (2 species)
    not a true protein
  7. 2789155Species Staphylococcus aureus [TaxId:1280] [225594] (1 PDB entry)
  8. 2789156Domain d4ohja1: 4ohj A:42-133 [240699]
    Other proteins in same PDB: d4ohja2, d4ohja3, d4ohjb2, d4ohjb3
    automated match to d4ohjb1

Details for d4ohja1

PDB Entry: 4ohj (more details), 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohja1 b.40.2.2 (A:42-133) automated matches {Staphylococcus aureus [TaxId: 1280]}
tndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgek
vdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d4ohja1:

Click to download the PDB-style file with coordinates for d4ohja1.
(The format of our PDB-style files is described here.)

Timeline for d4ohja1: