SCOPe 2.05: Domain d4ohcf_: 4ohc F:

Lineage for d4ohcf_ (4ohc F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [236647] (1 PDB entry)

8. Domain d4ohcf_: 4ohc F: [240698]
   automated match to d4ohca_
   complexed with act, edo, na

Details for d4ohcf_

PDB Entry: 4ohc, 1.85 Å

PDB Description: crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia

PDB Compounds: (F:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d4ohcf_:

Sequence; same for both SEQRES and ATOM records:

>d4ohcf_ c.61.1.0 (F:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tgydrqsisdttakillevqavhfnaekpfiftsgwaspvyidcrklisyprvrralmem
aettitrdigfeqidavaggetagipfaawiadrmmvpmqyvrkkpkgfgrnaqieghle
egsrvllvedlttdsrskinfvnalrtagatvnhcfvlfhynifkesvsvlkdidvdlha
latwwdvlrvakasgyfetktldevekflhapaewsaahggatap

Timeline for d4ohcf_:

• d4ohcf_ first appeared in SCOPe 2.04
  
• d4ohcf_ appears in SCOPe 2.06
  
• d4ohcf_ appears in the current release, SCOPe 2.08