Lineage for d4ohcf_ (4ohc F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891931Species Burkholderia cenocepacia [TaxId:216591] [236647] (1 PDB entry)
  8. 2891937Domain d4ohcf_: 4ohc F: [240698]
    automated match to d4ohca_
    complexed with act, edo, na

Details for d4ohcf_

PDB Entry: 4ohc (more details), 1.85 Å

PDB Description: crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia
PDB Compounds: (F:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d4ohcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohcf_ c.61.1.0 (F:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tgydrqsisdttakillevqavhfnaekpfiftsgwaspvyidcrklisyprvrralmem
aettitrdigfeqidavaggetagipfaawiadrmmvpmqyvrkkpkgfgrnaqieghle
egsrvllvedlttdsrskinfvnalrtagatvnhcfvlfhynifkesvsvlkdidvdlha
latwwdvlrvakasgyfetktldevekflhapaewsaahggatap

SCOPe Domain Coordinates for d4ohcf_:

Click to download the PDB-style file with coordinates for d4ohcf_.
(The format of our PDB-style files is described here.)

Timeline for d4ohcf_: