![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [236647] (1 PDB entry) |
![]() | Domain d4ohcb_: 4ohc B: [240694] automated match to d4ohca_ complexed with act, edo, na |
PDB Entry: 4ohc (more details), 1.85 Å
SCOPe Domain Sequences for d4ohcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohcb_ c.61.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tgydrqsisdttakillevqavhfnaekpfiftsgwaspvyidcrklisyprvrralmem aettitrdigfeqidavaggetagipfaawiadrmmvpmqyvrkkpkgfgrnaqieghle egsrvllvedlttdsrskinfvnalrtagatvnhcfvlfhynifkesvsvlkdidvdlha latwwdvlrvakasgyfetktldevekflhapaewsaahgga
Timeline for d4ohcb_: