SCOPe 2.08: Domain d4oh7b2: 4oh7 B:152-307

Lineage for d4oh7b2 (4oh7 B:152-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Brucella melitensis [TaxId:546272] [237214] (1 PDB entry)

8. Domain d4oh7b2: 4oh7 B:152-307 [240693]
   automated match to d4oh7a2
   complexed with cl, edo

Details for d4oh7b2

PDB Entry: 4oh7, 1.5 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from brucella melitensis

PDB Compounds: (B:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4oh7b2:

Sequence, based on SEQRES records:

>d4oh7b2 c.78.1.0 (B:152-307) automated matches {Brucella melitensis [TaxId: 546272]}
pikgktfawmgdgnnvlhslveaaarfdfnvniatpkgsepksqyidwarangagimstt
dpekaasgadcivtdtwvsmgqedharghnvfipyqvnanlmakadpkalfmhclpahrg
eevtdevidgpqsvvfdeaenrlhaqkailawclqd

Sequence, based on observed residues (ATOM records):

>d4oh7b2 c.78.1.0 (B:152-307) automated matches {Brucella melitensis [TaxId: 546272]}
pikgktfawmgdgnnvlhslveaaarfdfnvniatpkgssqyidwarangagimsttdpe
kaasgadcivtdtwvsmgqedharghnvfipyqvnanlmakadpkalfmhclpahrgeev
tdevidgpqsvvfdeaenrlhaqkailawclqd

Timeline for d4oh7b2:

• d4oh7b2 first appeared in SCOPe 2.04
  
• d4oh7b2 appears in SCOPe 2.07