Lineage for d4oh7b2 (4oh7 B:152-307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906923Species Brucella melitensis [TaxId:546272] [237214] (1 PDB entry)
  8. 2906927Domain d4oh7b2: 4oh7 B:152-307 [240693]
    automated match to d4oh7a2
    complexed with cl, edo

Details for d4oh7b2

PDB Entry: 4oh7 (more details), 1.5 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from brucella melitensis
PDB Compounds: (B:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4oh7b2:

Sequence, based on SEQRES records: (download)

>d4oh7b2 c.78.1.0 (B:152-307) automated matches {Brucella melitensis [TaxId: 546272]}
pikgktfawmgdgnnvlhslveaaarfdfnvniatpkgsepksqyidwarangagimstt
dpekaasgadcivtdtwvsmgqedharghnvfipyqvnanlmakadpkalfmhclpahrg
eevtdevidgpqsvvfdeaenrlhaqkailawclqd

Sequence, based on observed residues (ATOM records): (download)

>d4oh7b2 c.78.1.0 (B:152-307) automated matches {Brucella melitensis [TaxId: 546272]}
pikgktfawmgdgnnvlhslveaaarfdfnvniatpkgssqyidwarangagimsttdpe
kaasgadcivtdtwvsmgqedharghnvfipyqvnanlmakadpkalfmhclpahrgeev
tdevidgpqsvvfdeaenrlhaqkailawclqd

SCOPe Domain Coordinates for d4oh7b2:

Click to download the PDB-style file with coordinates for d4oh7b2.
(The format of our PDB-style files is described here.)

Timeline for d4oh7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4oh7b1