Lineage for d1lod.2 (1lod C:,D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164707Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 164721Domain d1lod.2: 1lod C:,D: [24069]

Details for d1lod.2

PDB Entry: 1lod (more details), 2.05 Å

PDB Description: interaction of a legume lectin with two components of the bacterial cell wall

SCOP Domain Sequences for d1lod.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lod.2 b.29.1.1 (C:,D:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

SCOP Domain Coordinates for d1lod.2:

Click to download the PDB-style file with coordinates for d1lod.2.
(The format of our PDB-style files is described here.)

Timeline for d1lod.2: