Lineage for d1lod.1 (1lod A:,B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226650Protein Legume lectin [49904] (22 species)
  7. 226758Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 226771Domain d1lod.1: 1lod A:,B: [24068]

Details for d1lod.1

PDB Entry: 1lod (more details), 2.05 Å

PDB Description: interaction of a legume lectin with two components of the bacterial cell wall

SCOP Domain Sequences for d1lod.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lod.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

SCOP Domain Coordinates for d1lod.1:

Click to download the PDB-style file with coordinates for d1lod.1.
(The format of our PDB-style files is described here.)

Timeline for d1lod.1: