SCOP 1.57: Domain d1lod.1: 1lod A:,B:

Lineage for d1lod.1 (1lod A:,B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (18 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1lod.1: 1lod A:,B: [24068]

Details for d1lod.1

PDB Entry: 1lod, 2.05 Å

PDB Description: interaction of a legume lectin with two components of the bacterial cell wall

SCOP Domain Sequences for d1lod.1:

Sequence; same for both SEQRES and ATOM records:

>g1lod.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

Timeline for d1lod.1:

• d1lod.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lod.1 appears in SCOP 1.59
  
• d1lod.1 appears in the current release, SCOPe 2.08