Lineage for d4oc9d_ (4oc9 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896870Species Campylobacter jejuni [TaxId:192222] [196590] (3 PDB entries)
  8. 2896878Domain d4oc9d_: 4oc9 D: [240677]
    automated match to d4oc9b_
    complexed with gol, imd, po4

Details for d4oc9d_

PDB Entry: 4oc9 (more details), 2.35 Å

PDB Description: 2.35 angstrom resolution crystal structure of putative o- acetylhomoserine (thiol)-lyase (mety) from campylobacter jejuni subsp. jejuni nctc 11168 with n'-pyridoxyl-lysine-5'-monophosphate at position 205
PDB Compounds: (D:) Putative O-acetylhomoserine (Thiol)-lyase

SCOPe Domain Sequences for d4oc9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oc9d_ c.67.1.0 (D:) automated matches {Campylobacter jejuni [TaxId: 192222]}
nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
fllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqai
es

SCOPe Domain Coordinates for d4oc9d_:

Click to download the PDB-style file with coordinates for d4oc9d_.
(The format of our PDB-style files is described here.)

Timeline for d4oc9d_: