SCOPe 2.04: Domain d4o9ka_: 4o9k A:

Lineage for d4o9ka_ (4o9k A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (13 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [236260] (1 PDB entry)

8. Domain d4o9ka_: 4o9k A: [240674]
   automated match to d4o9kb_
   complexed with cmk, gol

Details for d4o9ka_

PDB Entry: 4o9k, 1.85 Å

PDB Description: crystal structure of the cbs pair of a putative d-arabinose 5- phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo

PDB Compounds: (A:) arabinose 5-phosphate isomerase

SCOPe Domain Sequences for d4o9ka_:

Sequence; same for both SEQRES and ATOM records:

>d4o9ka_ d.37.1.0 (A:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
grrlltfvrdimhtgddtpvigleasvrdallemtakklgmtaivdgagtiqgvftdgdl
rrllekaqdihatpitavmtrscvtvegsllaaeavrimeqkrinalpvvengrligain
mhdllragvl

Timeline for d4o9ka_:

• d4o9ka_ is new in SCOPe 2.04-stable
  
• d4o9ka_ appears in SCOPe 2.05
  
• d4o9ka_ appears in the current release, SCOPe 2.08