SCOPe 2.04: Domain d4o9ea_: 4o9e A:

Lineage for d4o9ea_ (4o9e A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (18 species)
   not a true protein

7. Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (2 PDB entries)

8. Domain d4o9ea_: 4o9e A: [240673]
   automated match to d4o9eb_
   complexed with 4td, tdr, tyd

Details for d4o9ea_

PDB Entry: 4o9e, 2 Å

PDB Description: Crystal structure of QdtA, a sugar 3,4-ketoisemerase from Thermoanaerobacterium thermosaccharolyticum in complex with TDP

PDB Compounds: (A:) QdtA

SCOPe Domain Sequences for d4o9ea_:

Sequence; same for both SEQRES and ATOM records:

>d4o9ea_ b.82.1.0 (A:) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
yirnydfyideakkrfl

Timeline for d4o9ea_:

• d4o9ea_ is new in SCOPe 2.04-stable
  
• d4o9ea_ appears in SCOPe 2.05
  
• d4o9ea_ appears in the current release, SCOPe 2.08, called d4o9ea1