![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (181 species) not a true protein |
![]() | Species Brucella suis [TaxId:470137] [229017] (3 PDB entries) |
![]() | Domain d4o6vb_: 4o6v B: [240670] automated match to d4o6vc_ complexed with edo, gol |
PDB Entry: 4o6v (more details), 1.85 Å
SCOPe Domain Sequences for d4o6vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o6vb_ c.2.1.0 (B:) automated matches {Brucella suis [TaxId: 470137]} iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl qklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvpamq kqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwids lptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
Timeline for d4o6vb_: