Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Brucella suis [TaxId:470137] [229017] (4 PDB entries) |
Domain d4o6va_: 4o6v A: [240669] Other proteins in same PDB: d4o6vc2 automated match to d4o6vc_ complexed with edo, gol |
PDB Entry: 4o6v (more details), 1.85 Å
SCOPe Domain Sequences for d4o6va_:
Sequence, based on SEQRES records: (download)
>d4o6va_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]} iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl qklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvpamq kqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwids lptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
>d4o6va_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]} iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl qklvdqtlekwgridvlvnsagrapileitdedwhkgmdtyflnavrparlvvpamqkqk sgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwidslpt teerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
Timeline for d4o6va_:
View in 3D Domains from other chains: (mouse over for more information) d4o6vb_, d4o6vc1, d4o6vc2, d4o6vd_ |