Lineage for d4o6va_ (4o6v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846311Species Brucella suis [TaxId:470137] [229017] (4 PDB entries)
  8. 2846316Domain d4o6va_: 4o6v A: [240669]
    Other proteins in same PDB: d4o6vc2
    automated match to d4o6vc_
    complexed with edo, gol

Details for d4o6va_

PDB Entry: 4o6v (more details), 1.85 Å

PDB Description: crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase (ec 1.1.1.100) from brucella suis
PDB Compounds: (A:) Oxidoreductase, short-chain dehydrogenase/reductase family

SCOPe Domain Sequences for d4o6va_:

Sequence, based on SEQRES records: (download)

>d4o6va_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]}
iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl
qklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvpamq
kqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwids
lptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv

Sequence, based on observed residues (ATOM records): (download)

>d4o6va_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]}
iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl
qklvdqtlekwgridvlvnsagrapileitdedwhkgmdtyflnavrparlvvpamqkqk
sgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwidslpt
teerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv

SCOPe Domain Coordinates for d4o6va_:

Click to download the PDB-style file with coordinates for d4o6va_.
(The format of our PDB-style files is described here.)

Timeline for d4o6va_: