![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries) |
![]() | Domain d4o6rd1: 4o6r D:1-488 [240668] Other proteins in same PDB: d4o6ra2, d4o6rb2, d4o6rc2, d4o6rd2 automated match to d4o6rb_ complexed with amp, edo, gol, no3 |
PDB Entry: 4o6r (more details), 1.9 Å
SCOPe Domain Sequences for d4o6rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o6rd1 c.82.1.0 (D:1-488) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsamp aaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadklq gsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpls tlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqgn lkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafler fvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpalan gyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndls rahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvdg nvpphfkr
Timeline for d4o6rd1: