Lineage for d4nz0c_ (4nz0 C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018263Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 3018264Protein automated matches [226844] (11 species)
    not a true protein
  7. 3018300Species Mengo virus [TaxId:12107] [237860] (3 PDB entries)
  8. 3018305Domain d4nz0c_: 4nz0 C: [240662]
    automated match to d4nz0a_
    complexed with cl, gol

Details for d4nz0c_

PDB Entry: 4nz0 (more details), 2.8 Å

PDB Description: The EMCV 3Dpol structure at 2.8A resolution
PDB Compounds: (C:) Genome polyprotein

SCOPe Domain Sequences for d4nz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nz0c_ e.8.1.0 (C:) automated matches {Mengo virus [TaxId: 12107]}
galerlpdgprihvprktalrptvarqvfqpafapavlskfdprtdadvdevafskhtsn
qetlppvfrmvareyanrvfallgrdngrlsvkqaldglegmdpmdkntspglpyttlgm
rrtdvvdwetatlipfaaerlekmnnkdfsdivyqtflkdelrpiekvqaaktrivdvpp
fehcilgrqllgkfaskfqtqpglelgsaigcdpdvhwtafgvamqgfervydvdysnfd
sthsvamfrllaeeffseengfdplvkdyleslaiskhayeekrylitgglpsgcaatsm
lntimnniiiraglyltyknfefddvkvlsygddllvatnyqlnfdrvrtslaktgykit
panktstfplestledvvflkrkfkkegplyrpvmnrealeamlsyyrpgtlsekltsit
mlavhsgkqeydrlfapfrevgvivptfesveyrwrslfw

SCOPe Domain Coordinates for d4nz0c_:

Click to download the PDB-style file with coordinates for d4nz0c_.
(The format of our PDB-style files is described here.)

Timeline for d4nz0c_: