Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [237855] (2 PDB entries) |
Domain d4nv0b_: 4nv0 B: [240660] automated match to d4nv0a_ complexed with mg, mg7, mgf, pge |
PDB Entry: 4nv0 (more details), 1.65 Å
SCOPe Domain Sequences for d4nv0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nv0b_ c.108.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdytitkqrtedggavp ssfgifnacqslpenfkaetdklyhkyrpieidphmpiaekvqymiewwtksgeltsgfp fdqseidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvsvlrqanvlhpnv kvvsnflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhiivmgdsigdadm asgvpasshimkigflfdhveanmkkymdtfdivlvddqtmdvprtllsliekqhklnle
Timeline for d4nv0b_: