SCOPe 2.06: Domain d1log.1: 1log A:,B:

Lineage for d1log.1 (1log A:,B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1log.1: 1log A:,B: [24066]
   complexed with ca, mn

Details for d1log.1

PDB Entry: 1log, 2.1 Å

PDB Description: x-ray structure of a (alpha-man(1-3)beta-man(1-4)glcnac)-lectin complex at 2.1 angstroms resolution

PDB Compounds: (A:) legume isolectin I (alpha chain), (B:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1log.1:

Sequence; same for both SEQRES and ATOM records:

>g1log.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

Timeline for d1log.1:

• d1log.1 first appeared (with stable ids) in SCOP 1.55
  
• d1log.1 appears in SCOPe 2.05
  
• d1log.1 appears in SCOPe 2.07
  
• d1log.1 appears in the current release, SCOPe 2.08