![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
![]() | Protein automated matches [227124] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries) |
![]() | Domain d4nstd2: 4nst D:158-261 [240659] Other proteins in same PDB: d4nsta_, d4nstc_ automated match to d4nstb2 protein/RNA complex; complexed with adp, af3, edo, mg |
PDB Entry: 4nst (more details), 2.2 Å
SCOPe Domain Sequences for d4nstd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nstd2 a.74.1.0 (D:158-261) automated matches {Human (Homo sapiens) [TaxId: 9606]} ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqg
Timeline for d4nstd2:
![]() Domains from other chains: (mouse over for more information) d4nsta_, d4nstb1, d4nstb2, d4nstc_ |