SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4nstd2 (4nst D:158-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2001372Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2001373Protein automated matches [227124] (1 species)
    not a true protein
  7. 2001374Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries)
  8. 2001380Domain d4nstd2: 4nst D:158-261 [240659]
    Other proteins in same PDB: d4nsta_, d4nstc_
    automated match to d4nstb2
    protein/RNA complex; complexed with adp, af3, edo, mg

Details for d4nstd2

PDB Entry: 4nst (more details), 2.2 Å

PDB Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride
PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d4nstd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nstd2 a.74.1.0 (D:158-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqg

SCOPe Domain Coordinates for d4nstd2:

Click to download the PDB-style file with coordinates for d4nstd2.
(The format of our PDB-style files is described here.)

Timeline for d4nstd2: