Lineage for d4nstd1 (4nst D:21-157)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331828Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2331829Protein automated matches [227124] (1 species)
    not a true protein
  7. 2331830Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)
  8. 2331835Domain d4nstd1: 4nst D:21-157 [240658]
    Other proteins in same PDB: d4nsta_, d4nstc_
    automated match to d4nstb1
    protein/RNA complex; complexed with adp, af3, edo, mg

Details for d4nstd1

PDB Entry: 4nst (more details), 2.2 Å

PDB Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride
PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d4nstd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nstd1 a.74.1.0 (D:21-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
mvlerillqtikfdlqv

SCOPe Domain Coordinates for d4nstd1:

Click to download the PDB-style file with coordinates for d4nstd1.
(The format of our PDB-style files is described here.)

Timeline for d4nstd1: