Lineage for d4nrkf_ (4nrk F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969935Species Influenza b virus [TaxId:107412] [256374] (3 PDB entries)
  8. 1969941Domain d4nrkf_: 4nrk F: [240652]
    Other proteins in same PDB: d4nrka_, d4nrkc_, d4nrke_
    automated match to d1ti8b1
    complexed with nag; mutant

Details for d4nrkf_

PDB Entry: 4nrk (more details), 2.63 Å

PDB Description: structure of hemagglutinin with f95y mutation of influenza virus b/lee/40 complex with lstc
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4nrkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrkf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza b virus [TaxId: 107412]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamnelhdeileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsaveigngcfetkhkcnqtcldriaagtfnagdfslptfd

SCOPe Domain Coordinates for d4nrkf_:

Click to download the PDB-style file with coordinates for d4nrkf_.
(The format of our PDB-style files is described here.)

Timeline for d4nrkf_: