Lineage for d4nrkb_ (4nrk B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2267357Species Influenza b virus [TaxId:107412] [256374] (3 PDB entries)
  8. 2267361Domain d4nrkb_: 4nrk B: [240649]
    Other proteins in same PDB: d4nrka_, d4nrkc_, d4nrke_
    automated match to d1ti8b1
    complexed with nag; mutant

Details for d4nrkb_

PDB Entry: 4nrk (more details), 2.63 Å

PDB Description: structure of hemagglutinin with f95y mutation of influenza virus b/lee/40 complex with lstc
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4nrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrkb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza b virus [TaxId: 107412]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamnelhdeileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsaveigngcfetkhkcnqtcldriaagtfnagdfslptfd

SCOPe Domain Coordinates for d4nrkb_:

Click to download the PDB-style file with coordinates for d4nrkb_.
(The format of our PDB-style files is described here.)

Timeline for d4nrkb_: