Lineage for d4nnwt_ (4nnw T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230649Domain d4nnwt_: 4nnw T: [240641]
    Other proteins in same PDB: d4nnwa_, d4nnwb_, d4nnwc_, d4nnwd_, d4nnwe_, d4nnwg_, d4nnwh_, d4nnwi_, d4nnwj_, d4nnwk_, d4nnwl_, d4nnwm_, d4nnwn_, d4nnwo_, d4nnwp_, d4nnwq_, d4nnwr_, d4nnws_, d4nnwu_, d4nnwv_, d4nnww_, d4nnwx_, d4nnwy_, d4nnwz_
    automated match to d1irug_
    complexed with 2mk, mg

Details for d4nnwt_

PDB Entry: 4nnw (more details), 2.6 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoaldehyde
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4nnwt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnwt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4nnwt_:

Click to download the PDB-style file with coordinates for d4nnwt_.
(The format of our PDB-style files is described here.)

Timeline for d4nnwt_: