SCOPe 2.08: Domain d1loc.3: 1loc E:,F:

Lineage for d1loc.3 (1loc E:,F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1loc.3: 1loc E:,F: [24064]
   complexed with ca, mn

Details for d1loc.3

PDB Entry: 1loc, 2.05 Å

PDB Description: interaction of a legume lectin with two components of the bacterial cell wall

PDB Compounds: (E:) legume isolectin I (alpha chain), (F:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1loc.3:

Sequence; same for both SEQRES and ATOM records:

>g1loc.3 b.29.1.1 (E:,F:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

Timeline for d1loc.3:

• d1loc.3 first appeared (with stable ids) in SCOP 1.55
  
• d1loc.3 appears in SCOPe 2.07