![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries) |
![]() | Domain d4nhdd2: 4nhd D:175-316 [240635] Other proteins in same PDB: d4nhda3, d4nhdb3, d4nhdc3, d4nhdd3 complexed with ca, coa, na |
PDB Entry: 4nhd (more details), 1.78 Å
SCOPe Domain Sequences for d4nhdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhdd2 c.95.1.0 (D:175-316) automated matches {Vibrio cholerae [TaxId: 243277]} lsthihadgefgdllslevpvrggdsdkwlhmagnevfkvavtqlsklvvdtlkannmhk seldwlvphqanyriisatakklsmsldqvvitldrhgntsaatvptaldeavrdgriqr gqmllleafgggftwgsalvkf
Timeline for d4nhdd2: