Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Type II pantothenate kinase, CoaW [159626] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [159627] (2 PDB entries) Uniprot Q8NVG0 1-267 |
Domain d4nb4h_: 4nb4 H: [240621] automated match to d4nb4c_ complexed with adp, mg, sh3 |
PDB Entry: 4nb4 (more details), 2.25 Å
SCOPe Domain Sequences for d4nb4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nb4h_ c.55.1.14 (H:) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} gmkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviae ninipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigt gggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghv lhhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvved ytvlrgckpyyvengafsgaigalyle
Timeline for d4nb4h_: