Lineage for d4nb4h_ (4nb4 H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858450Family c.55.1.14: Fumble-like [159623] (4 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 1858481Protein Type II pantothenate kinase, CoaW [159626] (1 species)
  7. 1858482Species Staphylococcus aureus [TaxId:1280] [159627] (2 PDB entries)
    Uniprot Q8NVG0 1-267
  8. 1858492Domain d4nb4h_: 4nb4 H: [240621]
    automated match to d4nb4c_
    complexed with adp, mg, sh3

Details for d4nb4h_

PDB Entry: 4nb4 (more details), 2.25 Å

PDB Description: Pantothenamide-bound Pantothenate kinase from Staphylococcus aureus
PDB Compounds: (H:) Type II pantothenate kinase

SCOPe Domain Sequences for d4nb4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nb4h_ c.55.1.14 (H:) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]}
gmkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviae
ninipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigt
gggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghv
lhhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvved
ytvlrgckpyyvengafsgaigalyle

SCOPe Domain Coordinates for d4nb4h_:

Click to download the PDB-style file with coordinates for d4nb4h_.
(The format of our PDB-style files is described here.)

Timeline for d4nb4h_: