SCOPe 2.05: Domain d4nauc_: 4nau C:

Lineage for d4nauc_ (4nau C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (41 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)

8. Domain d4nauc_: 4nau C: [240618]
   automated match to d4naua_
   complexed with 2w3, ags

Details for d4nauc_

PDB Entry: 4nau, 2.33 Å

PDB Description: s. aureus coad with inhibitor

PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4nauc_:

Sequence; same for both SEQRES and ATOM records:

>d4nauc_ c.26.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

Timeline for d4nauc_:

• d4nauc_ first appeared in SCOPe 2.04
  
• d4nauc_ appears in SCOPe 2.06
  
• d4nauc_ appears in the current release, SCOPe 2.08