Lineage for d4nama2 (4nam A:16-225)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078445Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2078446Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2078447Family b.179.1.1: PA14 [254147] (2 protein domains)
    Pfam PF07691
  6. 2078458Protein PA14 [254334] (1 species)
  7. 2078459Species Bacillus anthracis [254763] (15 PDB entries)
  8. 2078464Domain d4nama2: 4nam A:16-225 [240616]
    Other proteins in same PDB: d4nama1
    complexed with ca

Details for d4nama2

PDB Entry: 4nam (more details), 1.7 Å

PDB Description: 1.7a structure of 5-fluoro tryptophan labeled protective antigen (w206y)
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d4nama2:

Sequence, based on SEQRES records: (download)

>d4nama2 b.179.1.1 (A:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytvd
vknkrtflspyisnihekkgltkyksspek

Sequence, based on observed residues (ATOM records): (download)

>d4nama2 b.179.1.1 (A:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinnkirlekgrlyqikiqyqrenptekgldfklywtdsq
nkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytvdvtfls
pyisnihltkyksspek

SCOPe Domain Coordinates for d4nama2:

Click to download the PDB-style file with coordinates for d4nama2.
(The format of our PDB-style files is described here.)

Timeline for d4nama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nama1