Lineage for d1lob.4 (1lob G:,H:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371377Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 371383Domain d1lob.4: 1lob G:,H: [24061]
    complexed with ca, mma, mn

Details for d1lob.4

PDB Entry: 1lob (more details), 2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide-binding site

SCOP Domain Sequences for d1lob.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lob.4 b.29.1.1 (G:,H:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

SCOP Domain Coordinates for d1lob.4:

Click to download the PDB-style file with coordinates for d1lob.4.
(The format of our PDB-style files is described here.)

Timeline for d1lob.4: