Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species) |
Species Nostoc sp. [TaxId:103690] [237663] (1 PDB entry) |
Domain d4n8xn_: 4n8x N: [240602] automated match to d4n8x3_ complexed with so4 |
PDB Entry: 4n8x (more details), 1.93 Å
SCOPe Domain Sequences for d4n8xn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8xn_ b.40.15.1 (N:) Carbon dioxide concentrating mechanism protein CcmL {Nostoc sp. [TaxId: 103690]} mqiakvrgtvvstqkdpslrgvkllllqlvdeegnllqkyevaadnsvgagfdewvlisr gsaarqllgneqrpvdaavvaiidtihvedrliyskkd
Timeline for d4n8xn_:
View in 3D Domains from other chains: (mouse over for more information) d4n8x1_, d4n8x2_, d4n8x3_, d4n8x4_, d4n8xa_, d4n8xb_, d4n8xc_, d4n8xd_, d4n8xe_, d4n8xf_, d4n8xg_, d4n8xh_, d4n8xi_, d4n8xj_, d4n8xk_, d4n8xl_, d4n8xm_, d4n8xo_, d4n8xp_, d4n8xq_, d4n8xr_, d4n8xs_, d4n8xt_, d4n8xu_, d4n8xv_, d4n8xw_, d4n8xx_, d4n8xy_, d4n8xz_ |