Lineage for d1lob.2 (1lob C:,D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663473Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 663477Domain d1lob.2: 1lob C:,D: [24059]

Details for d1lob.2

PDB Entry: 1lob (more details), 2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide- binding site
PDB Compounds: (C:) legume isolectin I (alpha chain), (D:) legume isolectin I (beta chain)

SCOP Domain Sequences for d1lob.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lob.2 b.29.1.1 (C:,D:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

SCOP Domain Coordinates for d1lob.2:

Click to download the PDB-style file with coordinates for d1lob.2.
(The format of our PDB-style files is described here.)

Timeline for d1lob.2: