Lineage for d4n64d_ (4n64 D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709806Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)
  8. 1709828Domain d4n64d_: 4n64 D: [240574]
    Other proteins in same PDB: d4n64a_, d4n64c_
    automated match to d4n5zb_
    complexed with nag

Details for d4n64d_

PDB Entry: 4n64 (more details), 2.7 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with a biantennary glycan receptor
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4n64d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n64d_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 1332244]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

SCOPe Domain Coordinates for d4n64d_:

Click to download the PDB-style file with coordinates for d4n64d_.
(The format of our PDB-style files is described here.)

Timeline for d4n64d_: