SCOPe 2.01: Domain d1loe.2: 1loe C:,D:

Lineage for d1loe.2 (1loe C:,D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1loe.2: 1loe C:,D: [24057]
   complexed with ca, mn

Details for d1loe.2

PDB Entry: 1loe, 1.9 Å

PDB Description: x-ray crystal structure determination and refinement at 1.9 angstroms resolution of isolectin i from the seeds of lathyrus ochrus

PDB Compounds: (C:) legume isolectin I (alpha chain), (D:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1loe.2:

Sequence; same for both SEQRES and ATOM records:

>g1loe.2 b.29.1.1 (C:,D:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
nXetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

Timeline for d1loe.2:

• d1loe.2 first appeared (with stable ids) in SCOP 1.55
  
• d1loe.2 appears in SCOP 1.75
  
• d1loe.2 appears in SCOPe 2.02
  
• d1loe.2 appears in the current release, SCOPe 2.08