Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries) |
Domain d4n61d_: 4n61 D: [240568] Other proteins in same PDB: d4n61a_, d4n61c_ automated match to d4n5zb_ complexed with gal, nag, sia |
PDB Entry: 4n61 (more details), 2.6 Å
SCOPe Domain Sequences for d4n61d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n61d_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 1332244]} gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
Timeline for d4n61d_: